Shopping Cart (0 item(s) - $0.00)

IGF-1 LR3 1MG

IGF-1 LR3 1MG

Product code: BUY-IGF-1-LR3

Availability: In stock

$79.99

Be the first to review this product

OR
Details

Details

All the information below is strictly for research purposes only. Under no circumstance should this chemical be used for human consumption.


  • CAS: 946870-92-4
  • Formula: C990H1528N262O300S7
  • Molecular weight: 9200
  • Peptide purity: > 99.0%
  • Chain: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA
 

IGF1-LR3 is also known as Long R3 IGF-1.  It is a growth factor similar to insulin, a variant of insulin group peptide hormones that has been modified.   The molecular formula is C990H1528N262O300S7, and the weight is 9.200. 

The included variations on this peptide are an additional 13 amino acids and one substitution that causes this version to be both stable and effective.  It also boasts a longer half-life and repels the binding of other proteins.

IGF1-LR3 was created purposely for use in researching cultured cells.  Currently, few researchers have actually confirmed the claim of stronger properties than original IGF, or that is promotes more dense muscle tissue cause by hyperplasia of cells.  

This is a research compound that is released in response to the G-hormone, and it stimulates cell functioning.  In addition, it causes cells to be more sensitive to insulin.  Studies may suggest these modifications in the structure encourage the transportation of glucose and amino acids to cells, and stimulate protein generation.

 

Chemical and other safety information:

 

H-statements (GHS/CLP): P-statements (GHS/CLP):
H302: Harmful if swallowed. P102: Keep out of reach of children.
H315: Causes skin irritation P232: Protect from moisture.
H319: Causes serious eye irritation. P235: Keep cool.
H332: Harmful if inhaled. P261: Avoid breathing dust/fume/gas/mist/vapours/spray.
  P264: Wash hands thoroughly after handling.
  P301+P312: IF SWALLOWED: Call a POISON CENTER or doctor/physician if you feel unwell.
  P302+P352: IF ON SKIN: Wash with plenty of soap and water.
  P301+P330+P331: IF SWALLOWED: rinse mouth. Do NOT induce vomiting.
  P332+313: If skin irritation occurs: Get medical advice/attention.
  P411+235: Store at temperatures not exceeding 8°C/46°F. Keep cool
Additional info

Product Tags

Use spaces to separate tags. Use single quotes (') for phrases.

Sign Up for Our Newsletter:

            Free Shipping On order over $150.00

NEWSLETTER
Subscribe
Sign up for our mailer list so you get monthly discounts !